Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NWYVKKCLNDVGICKKKCKPEELHVKNGRAMCGKQRDCCVPAD |
Activity | Antibacterial |
Host Chemicals | Hylobates lar |
Length | 43 |
SwissProt ID | A4H245 |
1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. High fat diet and GLP-1 drugs induce pancreatic injury in mice
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.