1. Home
  2. Products
  3. Therapeutic Peptides
  4. Peptide Inhibitors
  5. Beta-Endorphin

Beta-Endorphin

Beta-Endorphin is a long, amphipathic peptide composed of hydrophobic, charged, and aromatic residues that support complex folding. Its extended sequence makes it valuable for studies of binding equilibria, conformational transitions, and multivalent interactions. Researchers analyze its hydrogen-bond networks and domain flexibility. Applications include structural biochemistry, peptide engineering, and sequence-function research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Beta-Endorphin(CAS 60617-12-1)

CAT No: R2685

CAS No:60617-12-1

Synonyms/Alias:61214-51-5;beta-ENDORPHIN;BETA-ENDORPHIN HUMAN SYNTHETIC;beta-end;beta-Endorphin (sheep), 27-L-tyrosine-31-L-glutamic acid-;EINECS 262-330-3;60617-12-1;beta-Endorphin (human) trifluoroacetate salt;.beta.-endorphin;Endorphin, beta;UNII-3S51P4W3XQ;|A-Endorphin, human;??-Endorphin, human;?-ENDORPHIN;3S51P4W3XQ;GTPL1643;SCHEMBL6238339;CHEMBL1866903;27-L-Tyrosine-31-L-glutamic acid-beta-endorphin (sheep);beta-Endorphin (Human Synthetic);DTXSID30210135;DTXSID801053886;MFCD00076383;AKOS040740635;beta-Endorphin human, >=95% (HPLC);NCGC00163196-01;NCGC00163196-02;AS-83086;DA-68912;FE108749;F82167;262-330-3;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C158H251N39O46S
M.W/Mr.
3465
Sequence
One Letter Code:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Three Letter Code:H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
InChI
InChI=1S/C158H251N39O46S/c1-17-84(9)126(153(237)182-102(44-29-34-65-163)137(221)186-112(74-118(166)206)142(226)171-86(11)131(215)183-110(73-94-48-52-96(204)53-49-94)146(230)177-99(41-26-31-62-160)135(219)175-98(40-25-30-61-159)134(218)170-78-122(210)173-106(158(242)243)56-59-124(213)214)193-154(238)127(85(10)18-2)192-132(216)87(12)172-143(227)113(75-119(167)207)185-136(220)100(42-27-32-63-161)178-147(231)111(72-92-38-23-20-24-39-92)184-144(228)107(68-81(3)4)188-155(239)129(89(14)201)195-152(236)125(83(7)8)191-148(232)108(69-82(5)6)187-151(235)116-45-35-66-197(116)157(241)130(90(15)202)196-140(224)103(54-57-117(165)205)179-149(233)114(79-198)189-138(222)101(43-28-33-64-162)176-139(223)104(55-58-123(211)212)180-150(234)115(80-199)190-156(240)128(88(13)200)194-141(225)105(60-67-244-16)181-145(229)109(71-91-36-21-19-22-37-91)174-121(209)77-168-120(208)76-169-133(217)97(164)70-93-46-50-95(203)51-47-93/h19-24,36-39,46-53,81-90,97-116,125-130,198-204H,17-18,25-35,40-45,54-80,159-164H2,1-16H3,(H2,165,205)(H2,166,206)(H2,167,207)(H,168,208)(H,169,217)(H,170,218)(H,171,226)(H,172,227)(H,173,210)(H,174,209)(H,175,219)(H,176,223)(H,177,230)(H,178,231)(H,179,233)(H,180,234)(H,181,229)(H,182,237)(H,183,215)(H,184,228)(H,185,220)(H,186,221)(H,187,235)(H,188,239)(H,189,222)(H,190,240)(H,191,232)(H,192,216)(H,193,238)(H,194,225)(H,195,236)(H,196,224)(H,211,212)(H,213,214)(H,242,243)/t84-,85-,86-,87-,88+,89+,90+,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,125-,126-,127-,128-,129-,130-/m0/s1
InChI Key
JMHFFDIMOUKDCZ-NTXHZHDSSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServiceCustom Conjugation ServicePeptide CDMOPeptide Modification ServicesPeptide Analysis Services
Hot Products
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Aviptadil Acetate

Aviptadil Acetate is a vasoactive intestinal peptide for lung and immune research. Purchase this synthetic peptide for studies on pulmonary health and inflammation.

Read More Read More
Atosiban

Atosiban is a peptide oxytocin receptor antagonist that helps prevent preterm labor. Buy Atosiban peptide for reproductive and uterine contractility research.

Read More Read More
Argipressin

Argipressin peptide regulates water balance and blood pressure in biological systems. Shop pure Argipressin peptide online for cardiovascular and kidney research.

Read More Read More
Thymosin β4 Acetate

Thymosin β4 Acetate promotes wound healing, tissue repair, and cell regeneration. Buy Thymosin beta 4 peptide powder for research on recovery and regenerative medicine.

Read More Read More
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
Angiotensin II

Angiotensin II peptide regulates blood pressure and vascular constriction. Purchase this synthetic research peptide to support cardiovascular and renal function studies.

Read More Read More
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
Angiotensin II Acetate

Angiotensin II Acetate is a potent research peptide regulating blood pressure and vascular tone. Purchase this synthetic peptide to support cardiovascular and renal studies.

Read More Read More
Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers