Beta-Endorphin

Beta-Endorphin is a long, amphipathic peptide composed of hydrophobic, charged, and aromatic residues that support complex folding. Its extended sequence makes it valuable for studies of binding equilibria, conformational transitions, and multivalent interactions. Researchers analyze its hydrogen-bond networks and domain flexibility. Applications include structural biochemistry, peptide engineering, and sequence-function research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Beta-Endorphin(CAS 60617-12-1)

CAT No: R2685

CAS No:60617-12-1

Synonyms/Alias:61214-51-5;beta-ENDORPHIN;BETA-ENDORPHIN HUMAN SYNTHETIC;beta-end;beta-Endorphin (sheep), 27-L-tyrosine-31-L-glutamic acid-;EINECS 262-330-3;60617-12-1;beta-Endorphin (human) trifluoroacetate salt;.beta.-endorphin;Endorphin, beta;UNII-3S51P4W3XQ;|A-Endorphin, human;??-Endorphin, human;?-ENDORPHIN;3S51P4W3XQ;GTPL1643;SCHEMBL6238339;CHEMBL1866903;27-L-Tyrosine-31-L-glutamic acid-beta-endorphin (sheep);beta-Endorphin (Human Synthetic);DTXSID30210135;DTXSID801053886;MFCD00076383;AKOS040740635;beta-Endorphin human, >=95% (HPLC);NCGC00163196-01;NCGC00163196-02;AS-83086;DA-68912;FE108749;F82167;262-330-3;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C158H251N39O46S
M.W/Mr.
3465
Sequence
One Letter Code:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Three Letter Code:H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH

Beta-Endorphin is a naturally occurring endogenous opioid peptide that plays a critical role in the modulation of pain, mood, and immune responses within the central and peripheral nervous systems. As a member of the endorphin family, Beta-Endorphin is derived from the precursor protein proopiomelanocortin (POMC) and is primarily synthesized and released by the pituitary gland and certain neurons. Its unique structure allows it to bind selectively to opioid receptors, resulting in a wide range of physiological and biochemical effects. The compound is highly valued in research settings for its ability to mimic or influence natural opioid pathways, providing essential insights into neurobiology, stress responses, and behavioral science.

Neuroscience research: Beta-Endorphin serves as an indispensable tool for exploring the complexities of the brain's opioid system. By employing this peptide in experimental models, researchers can investigate the mechanisms underlying pain perception, analgesia, and reward pathways. The ability of Beta-Endorphin to modulate synaptic transmission and neurotransmitter release makes it highly relevant for studies focused on addiction, emotional regulation, and neurodegenerative disorders. Its use in electrophysiological and imaging studies allows for precise mapping of opioid receptor distribution and function within various brain regions, thereby advancing the understanding of neural circuitry involved in both physiological and pathological states.

Endocrinology studies: In the field of endocrinology, Beta-Endorphin is utilized to elucidate the interplay between the nervous and endocrine systems. Researchers leverage its regulatory effects on hormone secretion, particularly within the hypothalamic-pituitary-adrenal (HPA) axis, to investigate stress adaptation and homeostatic balance. Through in vitro and in vivo experiments, Beta-Endorphin provides a model to study feedback mechanisms that govern the release of corticotropin-releasing hormone (CRH), adrenocorticotropic hormone (ACTH), and other stress-related peptides. These insights are fundamental for unraveling the molecular basis of stress-related disorders and metabolic regulation.

Behavioral science investigations: Beta-Endorphin is frequently applied in behavioral paradigms to assess its influence on mood, motivation, and social interactions. Its role in modulating feelings of well-being and reward is of particular interest in studies examining depression, anxiety, and substance use disorders. By administering the peptide in animal models, scientists can observe alterations in locomotor activity, preference behaviors, and stress resilience, thereby identifying potential targets for therapeutic intervention. The compound's impact on emotional processing and coping strategies further supports its importance in the study of affective neuroscience.

Immunology research: The immunomodulatory properties of Beta-Endorphin have attracted significant attention in the field of immunology. Researchers employ this peptide to explore its effects on immune cell proliferation, cytokine production, and inflammation resolution. Its interactions with immune receptors and signaling pathways provide valuable data on the neuroimmune axis, highlighting the bidirectional communication between the nervous and immune systems. These studies contribute to a deeper understanding of how endogenous opioids can influence immune surveillance, tolerance, and the body's response to external stressors.

Analytical and assay development: Beta-Endorphin is widely used as a reference standard or analyte in the development and validation of bioanalytical methods. Its well-characterized structure and biological activity make it an ideal candidate for calibrating immunoassays, mass spectrometry protocols, and receptor binding studies. Researchers rely on this peptide to establish assay sensitivity, specificity, and reproducibility, which are essential for accurate quantification in complex biological matrices. The application of Beta-Endorphin in assay development also facilitates the discovery of novel biomarkers and the evaluation of pharmacological agents targeting opioid pathways, thereby supporting advancements in both basic and translational research.

InChI
InChI=1S/C158H251N39O46S/c1-17-84(9)126(153(237)182-102(44-29-34-65-163)137(221)186-112(74-118(166)206)142(226)171-86(11)131(215)183-110(73-94-48-52-96(204)53-49-94)146(230)177-99(41-26-31-62-160)135(219)175-98(40-25-30-61-159)134(218)170-78-122(210)173-106(158(242)243)56-59-124(213)214)193-154(238)127(85(10)18-2)192-132(216)87(12)172-143(227)113(75-119(167)207)185-136(220)100(42-27-32-63-161)178-147(231)111(72-92-38-23-20-24-39-92)184-144(228)107(68-81(3)4)188-155(239)129(89(14)201)195-152(236)125(83(7)8)191-148(232)108(69-82(5)6)187-151(235)116-45-35-66-197(116)157(241)130(90(15)202)196-140(224)103(54-57-117(165)205)179-149(233)114(79-198)189-138(222)101(43-28-33-64-162)176-139(223)104(55-58-123(211)212)180-150(234)115(80-199)190-156(240)128(88(13)200)194-141(225)105(60-67-244-16)181-145(229)109(71-91-36-21-19-22-37-91)174-121(209)77-168-120(208)76-169-133(217)97(164)70-93-46-50-95(203)51-47-93/h19-24,36-39,46-53,81-90,97-116,125-130,198-204H,17-18,25-35,40-45,54-80,159-164H2,1-16H3,(H2,165,205)(H2,166,206)(H2,167,207)(H,168,208)(H,169,217)(H,170,218)(H,171,226)(H,172,227)(H,173,210)(H,174,209)(H,175,219)(H,176,223)(H,177,230)(H,178,231)(H,179,233)(H,180,234)(H,181,229)(H,182,237)(H,183,215)(H,184,228)(H,185,220)(H,186,221)(H,187,235)(H,188,239)(H,189,222)(H,190,240)(H,191,232)(H,192,216)(H,193,238)(H,194,225)(H,195,236)(H,196,224)(H,211,212)(H,213,214)(H,242,243)/t84-,85-,86-,87-,88+,89+,90+,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,125-,126-,127-,128-,129-,130-/m0/s1
InChI Key
JMHFFDIMOUKDCZ-NTXHZHDSSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide CDMOPeptide Modification ServicesPeptide Synthesis ServicesEpitope Mapping ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers