Beta-Endorphin

Beta-Endorphin is a long, amphipathic peptide composed of hydrophobic, charged, and aromatic residues that support complex folding. Its extended sequence makes it valuable for studies of binding equilibria, conformational transitions, and multivalent interactions. Researchers analyze its hydrogen-bond networks and domain flexibility. Applications include structural biochemistry, peptide engineering, and sequence-function research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Beta-Endorphin(CAS 60617-12-1)

CAT No: R2685

CAS No:60617-12-1

Synonyms/Alias:61214-51-5;beta-ENDORPHIN;BETA-ENDORPHIN HUMAN SYNTHETIC;beta-end;beta-Endorphin (sheep), 27-L-tyrosine-31-L-glutamic acid-;EINECS 262-330-3;60617-12-1;beta-Endorphin (human) trifluoroacetate salt;.beta.-endorphin;Endorphin, beta;UNII-3S51P4W3XQ;|A-Endorphin, human;??-Endorphin, human;?-ENDORPHIN;3S51P4W3XQ;GTPL1643;SCHEMBL6238339;CHEMBL1866903;27-L-Tyrosine-31-L-glutamic acid-beta-endorphin (sheep);beta-Endorphin (Human Synthetic);DTXSID30210135;DTXSID801053886;MFCD00076383;AKOS040740635;beta-Endorphin human, >=95% (HPLC);NCGC00163196-01;NCGC00163196-02;AS-83086;DA-68912;FE108749;F82167;262-330-3;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C158H251N39O46S
M.W/Mr.
3465
Sequence
One Letter Code:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Three Letter Code:H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
InChI
InChI=1S/C158H251N39O46S/c1-17-84(9)126(153(237)182-102(44-29-34-65-163)137(221)186-112(74-118(166)206)142(226)171-86(11)131(215)183-110(73-94-48-52-96(204)53-49-94)146(230)177-99(41-26-31-62-160)135(219)175-98(40-25-30-61-159)134(218)170-78-122(210)173-106(158(242)243)56-59-124(213)214)193-154(238)127(85(10)18-2)192-132(216)87(12)172-143(227)113(75-119(167)207)185-136(220)100(42-27-32-63-161)178-147(231)111(72-92-38-23-20-24-39-92)184-144(228)107(68-81(3)4)188-155(239)129(89(14)201)195-152(236)125(83(7)8)191-148(232)108(69-82(5)6)187-151(235)116-45-35-66-197(116)157(241)130(90(15)202)196-140(224)103(54-57-117(165)205)179-149(233)114(79-198)189-138(222)101(43-28-33-64-162)176-139(223)104(55-58-123(211)212)180-150(234)115(80-199)190-156(240)128(88(13)200)194-141(225)105(60-67-244-16)181-145(229)109(71-91-36-21-19-22-37-91)174-121(209)77-168-120(208)76-169-133(217)97(164)70-93-46-50-95(203)51-47-93/h19-24,36-39,46-53,81-90,97-116,125-130,198-204H,17-18,25-35,40-45,54-80,159-164H2,1-16H3,(H2,165,205)(H2,166,206)(H2,167,207)(H,168,208)(H,169,217)(H,170,218)(H,171,226)(H,172,227)(H,173,210)(H,174,209)(H,175,219)(H,176,223)(H,177,230)(H,178,231)(H,179,233)(H,180,234)(H,181,229)(H,182,237)(H,183,215)(H,184,228)(H,185,220)(H,186,221)(H,187,235)(H,188,239)(H,189,222)(H,190,240)(H,191,232)(H,192,216)(H,193,238)(H,194,225)(H,195,236)(H,196,224)(H,211,212)(H,213,214)(H,242,243)/t84-,85-,86-,87-,88+,89+,90+,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,125-,126-,127-,128-,129-,130-/m0/s1
InChI Key
JMHFFDIMOUKDCZ-NTXHZHDSSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Analysis ServicesPeptide CDMOcGMP Peptide ServicePeptide Modification ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers