Keywords Search Google Search Search

BHT-A1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2041
Sequence	GTTVVNSTFSIVLGNKGYICTVTVECMRNCQ
Activity	Gram+,

CAT#	Product Name	Inquiry
AF2236	Brevinin-2HSb	Inquiry
AF1420	XPF-St8	Inquiry
AF2449	Beta-defensin 8	Inquiry
AF2283	Antimicrobial peptide Def1-2	Inquiry
AF195	Temporin-1Cd	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The source and function of tripeptide-1 kollaren

of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...

Function of NoxA1ds in Colon Cancer

NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...

Palmitoyl Hexapeptide-12, a natural powerful antiager

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

Methamphetamine and Substance P

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Streptococcus rattus BHT
Length	31