Big Endothelin-1 (rat) trifluoroacetate salt

Big Endothelin-1 (rat) trifluoroacetate salt is a precursor peptide segment used to study proteolytic activation and structural evolution in the endothelin family. Its length supports examination of folding intermediates and disulfide architecture. The peptide is used in conformational and interaction research. Applications include structural modeling and sequence-function analysis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: E09049

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₉₂H₂₉₂N₅₀O₅₈S₅
M.W/Mr.
4389.06
Sequence
One Letter Code: CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS
three Letter Code: H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH trifluoroacetate salt (Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOcGMP Peptide ServiceCustom Conjugation ServicePeptide Synthesis ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Modification ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers