Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₉₂H₂₉₂N₅₀O₅₈S₅ |
M.W/Mr. | 4389.06 |
Sequence | One Letter Code: CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS three Letter Code: H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH trifluoroacetate salt (Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹) |
Source# | Synthetic |
1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.