Big Endothelin-1 (1-38), human represents a propeptide form containing key motifs required for enzymatic processing. The sequence carries cysteine residues that direct disulfide-driven folding and structural organization. Its length allows mapping of cleavage sites and precursor dynamics. Researchers apply it in biosynthetic pathway analysis and peptide maturation studies.
CAT No: B1501
CAS No:120796-97-6
Synonyms/Alias:big et-1 (1-38) (human);121014-53-7;DTXSID20856167;PUBCHEM_71581474;FB110372;120796-97-6;H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Le u-Gly-Ser-Pro-Arg-Ser-OH; H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH;
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
2. Emu oil in combination with other active ingredients for treating skin imperfections
3. Myotropic activity of allatostatins in tenebrionid beetles
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.