Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC |
Activity | Fungi, |
Host Chemicals | Brassica napus |
Length | 50 |
SwissProt ID | SwissProt ID: Q39313 |
1. Myotropic activity of allatostatins in tenebrionid beetles
2. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.