Home > Product > Antimicrobial Peptides > Bn-AFP1

Antimicrobial Peptides

CAT#
AF3269
Sequence
KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC
Host Chemicals
Brassica napus
Length
50
Activity
Fungi,
SwissProt ID
SwissProt ID: Q39313

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.