Home > Product > Catalog Peptides > Others > Botulinum Neurotoxin (BoNT) B Substrate Modification,amide, FITC - labeled

Others

Botulinum Neurotoxin (BoNT) B Substrate Modification,amide, FITC - labeled

Price Inquiry
CAT#
T09019
Sequence
FITCLCLSELDDRADALQAGASQFESSAAKLKRKYWWKNLK-NH2
M.W/Mr.
4516
Length
41

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.