Home > Product > Antimicrobial Peptides > Brazzein

Antimicrobial Peptides

CAT#
AF3307
Sequence
QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Host Chemicals
pulp, fruits, Pentadiplandra brazzeana Baillon
Length
54
Activity
Gram+ & Gram-, Fungi,
SwissProt ID
PDB ID: 1BRZ

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.