Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GAFGDLLKGVAKEAGMKLLNMAQCKLSGKC |
Activity | Gram+ & Gram-, |
Host Chemicals | the broad-folded frog, Hylarana latouchii, China, Asia |
Length | 30 |
2. Emu oil in combination with other active ingredients for treating skin imperfections
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.