Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4248.6 |
Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |
Length | 34 |
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
3. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.