Keywords Search Google Search Search

C34 gp41 HIV Fragment

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	H09874
M.W/Mr.	4248.6
Sequence	WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL

CAT#	Product Name	Inquiry
HB00167	HIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt	Inquiry
HB00163	HIV (gp120) Fragment (318-327)	Inquiry
HB00161	HIV (gp120) Fragment (421-438) trifluoroacetate salt	Inquiry
HB00160	HIV (gp120) Fragment (308-331)	Inquiry
HB00158	HIV (gp120) Fragment (254-274)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The efficacy of teicoplanin in the treatment of Gram-positive cocci infection

Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Function of Huwentoxin-XVI in analgesia

Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...

Inhibition of mast cell tryptase by APC 366

APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: