Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QWGYNSYGYGNYGGYGGYPMYGGYGMNGGYGGGGLLGMFLGKKK |
Activity | Antifungal |
Host Chemicals | Caenorhabditis elegans |
Length | 44 |
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.