Home > Product > Antimicrobial Peptides > Caenacin-1

Antimicrobial Peptides

Caenacin-1

Price Inquiry
CAT#
AF3117
Sequence
QWGYNSYGYGNYGGYGGYPMYGGYGMNGGYGGGGLLGMFLGKKK
Host Chemicals
Caenorhabditis elegans
Length
44
Activity
Antifungal

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.