Calcitonin human

Calcitonin human is a regulatory peptide with defined α-helical character that contributes to receptor-binding studies. Its amphipathic nature supports folding and solution-structure analysis. The peptide aids in examining biosynthetic pathways and structural motifs. Applications include peptide engineering and ligand-protein interaction research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C05039

CAS No:21215-62-3

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C151H226N40O45S3
M.W/Mr.
3417.9
Sequence
One Letter Code: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (C1&C7 bridge)
three Letter Code: H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (trifluoroacetate salt)(Cys1 and 7 bridge)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide CDMOPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Analysis ServicesPeptide Synthesis ServicesEpitope Mapping ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers