Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca2+ release .
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₃₁H₃₇₃N₆₉O₇₀S₂ |
M.W/Mr. | 5301.10 |
Sequence | One Letter Code: GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA three Letter Code: Gly-Val-Met-Pro-Arg-Glu-Glu-Thr-Asp-Ser-Lys-Thr-Ala-Ser-Pro-Trp-Lys-Ser-Ala-Arg-Leu-Met-Val-His-Thr-Val-Ala-Thr-Phe-Asn-Ser-Ile-Lys-Glu-Leu-Asn-Glu-Arg-Trp-Arg-Ser-Leu-Gln-Gln-Leu-Ala |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.