Calmodulin Binding Peptide 1

Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca2+ release .

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1266

CAS No:104041-80-7

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₃₁H₃₇₃N₆₉O₇₀S₂
M.W/Mr.
5301.10
Sequence
One Letter Code: GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA
three Letter Code: Gly-Val-Met-Pro-Arg-Glu-Glu-Thr-Asp-Ser-Lys-Thr-Ala-Ser-Pro-Trp-Lys-Ser-Ala-Arg-Leu-Met-Val-His-Thr-Val-Ala-Thr-Phe-Asn-Ser-Ile-Lys-Glu-Leu-Asn-Glu-Arg-Trp-Arg-Ser-Leu-Gln-Gln-Leu-Ala

Calmodulin Binding Peptide 1 is a synthetic peptide sequence specifically designed to interact with calmodulin, a ubiquitous calcium-binding messenger protein critical for numerous cellular signaling pathways. As a specialized peptide reagent, it mimics natural calmodulin target motifs, enabling precise modulation and interrogation of calmodulin-dependent processes in vitro and in cellular systems. Its defined structure and affinity for calmodulin make it a valuable molecular tool for researchers investigating calcium-mediated signaling, protein-protein interactions, and related biochemical mechanisms. The peptide's utility extends across disciplines such as molecular biology, biochemistry, and cell biology, where understanding calmodulin's role is essential for elucidating key regulatory pathways.

Protein Interaction Studies: Calmodulin Binding Peptide 1 is widely employed as a probe in protein-protein interaction assays to elucidate the binding dynamics between calmodulin and its target sequences. By incorporating this peptide into pull-down assays, co-immunoprecipitation experiments, or surface plasmon resonance analyses, researchers can quantitatively assess calmodulin's binding affinity and specificity. Such studies are fundamental for mapping calmodulin's interaction landscape, identifying novel binding partners, and characterizing the molecular determinants of calmodulin recognition.

Signal Transduction Research: The peptide serves as a functional mimic of endogenous calmodulin-binding domains, providing a controlled means to modulate calcium-calmodulin signaling pathways in experimental systems. By introducing Calmodulin Binding Peptide 1 into cell lysates or reconstituted signaling complexes, scientists can competitively inhibit or sequester calmodulin, thereby dissecting the downstream effects on kinases, phosphatases, and other calmodulin-regulated effectors. This approach allows for detailed mechanistic studies of calcium-dependent signal transduction and the validation of pathway components.

Affinity Purification: Calmodulin Binding Peptide 1 is frequently utilized as an affinity tag for the purification of recombinant proteins that interact with calmodulin. When fused to target proteins, the peptide enables selective capture using calmodulin-agarose or other calmodulin-affinity matrices under calcium-dependent conditions. This strategy streamlines the isolation of calmodulin-interacting proteins and facilitates downstream biochemical or structural analyses by providing highly specific enrichment of the protein of interest.

Fluorescence and Biosensor Assays: In the development of biosensors and fluorescence-based assays, the peptide is integrated as a recognition element to monitor calmodulin activity or calcium fluctuations in real time. By labeling Calmodulin Binding Peptide 1 with suitable fluorophores or incorporating it into sensor constructs, researchers can generate sensitive detection systems for studying dynamic changes in calmodulin conformation or cellular calcium levels. These applications are particularly valuable in high-throughput screening, live-cell imaging, and the quantitative analysis of signaling events.

Structural and Biophysical Analysis: The defined sequence and calmodulin affinity of the peptide make it an ideal substrate for structural studies, including X-ray crystallography, NMR spectroscopy, and molecular dynamics simulations. By forming stable complexes with calmodulin, the peptide supports detailed investigations into the conformational changes and binding interfaces involved in calmodulin recognition. Such structural insights are essential for rational drug design, the engineering of novel peptide inhibitors, and the broader understanding of calcium-mediated regulatory mechanisms in cells.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOCustom Conjugation ServicecGMP Peptide ServicePeptide Synthesis ServicesPeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Analysis ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers