CAP-18, rabbit

This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3343
M.W/Mr.	4433.7
Sequence	One Letter Code: GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY Three Letter Code: H-Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-OH

CAT#	Product Name	Inquiry
AF2793	Moricin-like peptide A	Inquiry
AF937	Nigrocin-2JDb	Inquiry
AF739	Kunitz-type serine protease inhibitor 1	Inquiry
AF3316	Pilosulin 1	Inquiry
AF2173	Psalmopeotoxin-1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.