CAP-18, rabbit

This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: AF3343

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
4433.7
Sequence
One Letter Code: GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Three Letter Code: H-Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-OH
References
Travis, S et al. Infect. Immun. 68, 2748 (2000).

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServicePeptide Analysis ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers