CAT# | C24004 |
M.F/Formula | C226H367N65O65S7 |
M.W/Mr. | 5259.26 |
Sequence | IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
Length | 48 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C24002 | CART (62-76) (human, rat) | Inquiry | ||
C24001 | CART (61-102) (human, rat) | Inquiry | ||
C24003 | CART (55-102) (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...