Cecropin B, Free Acid

Cecropin B, Free Acid, is an amphipathic α-helical antimicrobial peptide used to study membrane disruption and charge-dependent interactions. Its residue distribution supports evaluations of hydrophobic moment and helix stability. Researchers examine conformational transitions in lipid-mimetic environments. The molecule contributes to innate-immunity peptide modeling.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C13006

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C176H301N51O42S1
M.W/Mr.
3835.7
Sequence
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
Length
35

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Analysis ServicesPeptide CDMOPeptide Modification ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisCustom Conjugation ServiceEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers