Keywords Search Google Search Search

Cecropin-B2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2362
Sequence	GRSKKLGKKIEKAGKRVFNAAQKGLPVAAGVQAL
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2321	Andersonin-3 peptide precursor	Inquiry
AF2043	Psyle E	Inquiry
AF1502	Antifungal protein 1	Inquiry
AF949	Nigrocin-2SCb	Inquiry
AF1891	Brevinin-2-RN2	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Brief introduction of insulin-like growth factors

IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

The mechanism of R18 on 14-3-3 protein

R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Culex pipiens pipiens
Length	34
SwissProt ID	Q86PR4