We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
CRF, bovine (TFA) is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.
CAT No: R1307
Synonyms/Alias: Corticotropin Releasing Factor bovine (TFA)
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₀₈H₃₄₁F₃N₆₀O₆₅S |
M.W/Mr. | 4811.36 |
Sequence | One Letter Code: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 three Letter Code: Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 |
2. Myotropic activity of allatostatins in tenebrionid beetles
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.