CRF, bovine TFA

CRF, bovine (TFA) is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1307

Synonyms/Alias:Corticotropin Releasing Factor bovine (TFA)

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₀₈H₃₄₁F₃N₆₀O₆₅S
M.W/Mr.
4811.36
Sequence
One Letter Code: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
three Letter Code: Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

Corticotropin-Releasing Factor, bovine TFA salt, is a synthetic peptide corresponding to the naturally occurring corticotropin-releasing hormone found in bovine species. As a member of the neuropeptide hormone family, it plays a central role in regulating the hypothalamic-pituitary-adrenal (HPA) axis by stimulating the release of adrenocorticotropic hormone (ACTH) from the anterior pituitary. Its conserved sequence and biological activity make it a valuable tool for probing neuroendocrine signaling and stress response pathways in various research models. The trifluoroacetate (TFA) salt form enhances its solubility and stability for laboratory applications, supporting its use in peptide research and functional assays.

Neuroendocrine research: CRF peptides are widely utilized to investigate the mechanisms underlying stress response and HPA axis regulation. By serving as a potent agonist at CRF receptors, the compound enables researchers to model acute and chronic stress paradigms in vitro and in vivo, facilitating the study of downstream signaling events, receptor pharmacology, and gene expression changes associated with neuroendocrine adaptation. Such research is essential for understanding the molecular basis of stress-related disorders and the physiological integration of neuroendocrine signals.

Peptide receptor studies: The bovine CRF peptide serves as a reference ligand for characterizing CRF receptor subtype specificity, binding affinity, and signal transduction pathways. Utilizing this peptide in receptor binding assays and functional studies allows for the systematic dissection of CRF receptor pharmacodynamics, supporting the development and validation of novel agonists, antagonists, and allosteric modulators targeting these pathways. These investigations are critical for advancing knowledge of neuropeptide-receptor interactions and their broader physiological roles.

Peptide synthesis and analytical validation: As a well-characterized neuropeptide, bovine CRF is frequently employed as a standard or positive control in peptide synthesis, purification, and analytical workflows. Its defined sequence and predictable chromatographic behavior make it ideal for calibrating HPLC systems, validating mass spectrometry protocols, and benchmarking peptide quantitation methods. This utility ensures the reliability and reproducibility of peptide-based analytical platforms in research and development settings.

Cellular signaling assays: The peptide is instrumental in cell-based assays designed to elucidate intracellular signaling cascades activated by CRF receptor engagement. By applying the compound to cultured neuronal or endocrine cells, researchers can monitor second messenger production, kinase activation, and transcriptional responses, thereby mapping the intracellular networks that mediate neuropeptide hormone action. These studies provide valuable insights into the molecular mechanisms governing cellular adaptation to stress and environmental stimuli.

Behavioral neuroscience: In animal models, exogenous administration of CRF peptides enables the exploration of behavioral responses to stress, anxiety, and environmental challenges. Researchers leverage this tool to dissect the neurobiological substrates of behavior by correlating peptide-induced changes with alterations in neural circuitry, neurotransmitter release, and behavioral phenotypes. Such investigations contribute to a deeper understanding of the neural basis of emotion, motivation, and adaptive behaviors in mammals.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide CDMOPeptide Synthesis ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServiceEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers