Home > Product > Antimicrobial Peptides > Cyclotide vibi-E

Antimicrobial Peptides

Cyclotide vibi-E

Price Inquiry
CAT#
AF1904
Sequence
GIPCAESCVWIPCTVTALIGCGCSNKVCYN
Host Chemicals
Viola biflora
Length
30
Activity
Antimicrobial, Anticancer
SwissProt ID
B1NRQ8

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.