Keywords Search Google Search Search

Cycloviolacin O19

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2040
Sequence	GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF2468	Beta-defensin-1	Inquiry
AF269	Temporin-1CEe	Inquiry
AF2370	Canine beta-defensin	Inquiry
AF2893	Hepcidin-like antimicrobial peptide precursor	Inquiry
AF412	Putative antimicrobial protein	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Methamphetamine and Substance P

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

Compstatin: a pharmaceutical inhibitor of complement

Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...

Brief introduction of insulin-like growth factors

IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...

An antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class - Eptifibatide Acetate

Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...

Function of ICI 174,864 in traumatic hemorrhagic shock

ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Viola odorata
Length	31