Home > Product > Antimicrobial Peptides > Defensin-B2

Antimicrobial Peptides

Defensin-B2

Price Inquiry
CAT#
AF2940
Sequence
GLNNKCAYFRGQCRRKCPQRDIFFGFCRNHDQCCLSSLHTRH
Host Chemicals
Ornithorhynchus anatinus
Length
42
Activity
Antimicrobial
SwissProt ID
P0C8A6

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.