Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRRRCFCTRNC |
Length | 47 |
Modifications | Disulfide bonds(4) |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
4. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.