Home > Product > Catalog Peptides > Exendins and Fragments > Des His1, Glu8 Exendin-4

Exendins and Fragments

Des His1, Glu8 Exendin-4

Price Inquiry
CAT#
E10004
Sequence
GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
4063.6
Molecular Formula
C179H277N47O59S1
Length
38

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.