Des His1, Glu8 Exendin-4

Des His1, Glu8 Exendin-4 removes two charged residues, reshaping the N-terminal electrostatic landscape. The modified sequence enables evaluation of positions critical for receptor binding and activation. Researchers apply this analog to dissect exendin-4 domain contributions to secondary structure. Its engineered alterations support comparative structure-activity and signaling studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: E10004

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C179H277N47O59S1
M.W/Mr.
4063.6
Sequence
GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Length
38

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesCustom Conjugation ServicePeptide Synthesis ServicescGMP Peptide ServiceEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide CDMOPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers