Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C179H277N47O59S1 |
M.W/Mr. | 4063.6 |
Sequence | GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Length | 38 |
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.