Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C149H242N38O44S1 |
M.W/Mr. | 3302.0 |
Sequence | GGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
Length | 30 |
3. Emu oil in combination with other active ingredients for treating skin imperfections
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.