Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | TKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAIPGKC |
Activity | Antibacterial |
Host Chemicals | Carnobacterium divergens |
Length | 43 |
SwissProt ID | Q9Z4J1 |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.