CAT# | AF3061 |
Sequence | DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC |
Activity | Antifungal |
Host Chemicals | Drosophila melanogaster | Length | 44 | SwissProt ID | P41964 | Modifications | Disulfide bond(4) |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2125 | Oreoch-3 | Inquiry | ||
AF053 | Theta defensin subunit C | Inquiry | ||
AF1183 | Brevinin-1LF3 antimicrobial peptide precursor | Inquiry | ||
AF330 | Temporin-1DRa | Inquiry | ||
AF642 | Protegrin-5 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...