Home > Product > Catalog Peptides > Others > β-Endorphin, human

Others

β-Endorphin, human

Price Inquiry
CAT#
E05025
Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
M.W/Mr.
3465.1
Length
31

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.