Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3466.1 |
Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ |
Length | 31 |
2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.