Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
Activity | Antibacterial |
Host Chemicals | Sus scrofa |
Length | 32 |
SwissProt ID | P80230 |
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.