Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR |
Activity | Antibacterial |
Host Chemicals | Bos taurus |
Length | 38 |
SwissProt ID | O02775 |
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.