Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SLGPAIKATRQVCPKATRFVTVSCKKSDCQ |
Activity | Antibacterial |
Host Chemicals | Staphylococcus epidermidis |
Length | 30 |
SwissProt ID | O54220 |
1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
3. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.