Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | GIFSALAAGVKLLGNTLFKMAGKAGAEHLACKATNQC |
Activity | Antibacterial, Antifungal |
Host Chemicals | Rana pretiosa |
Length | 37 |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.