Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | TLKKPLLLIVLLGIISLSLCEQERAADEDEGSEIKRGLFSKFAGK |
Activity | Antimicrobial |
Host Chemicals | Odorrana margaretae |
Length | 45 |
SwissProt ID | E1AWC0 |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.