Home > Product > Antimicrobial Peptides > Esculentin-2-OG5 antimicrobial peptide

Antimicrobial Peptides

Esculentin-2-OG5 antimicrobial peptide

Price Inquiry
CAT#
AF2621
Sequence
GLFTLIKGAAKLIGRTVAKEAGKTGLELMACKITNQC
Host Chemicals
Rana grahami
Length
37
Activity
Antimicrobial
SwissProt ID
A6MAX6

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.