Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GLFTLIKGAAKLIGRTVAKEAGKTGLELMACKITNQC |
Activity | Antimicrobial |
Host Chemicals | Rana grahami |
Length | 37 |
SwissProt ID | A6MAX6 |
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.