Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANINCWCET |
Activity | Antifungal |
Host Chemicals | Synthetic construct |
Length | 44 |
1. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.