Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFLNVNCWCET |
Activity | Antifungal |
Host Chemicals | Synthetic construct |
Length | 44 |
1. Myotropic activity of allatostatins in tenebrionid beetles
2. High fat diet and GLP-1 drugs induce pancreatic injury in mice
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.