Exendin (5-39)

Exendin (5-39) retains much of the N-terminal region while omitting the first four residues, allowing nuanced investigation of initial docking events. The peptide preserves the extended helical domain and C-terminal segment. Researchers apply it in structure-activity and receptor-binding comparisons along the exendin series. Its intermediate length aids correlation of sequence and functional output.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: E10009

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
3806.3
Sequence
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Length
35

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide CDMOPeptide Modification ServicescGMP Peptide ServicePeptide Synthesis ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers