Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3806.3 |
Sequence | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Length | 35 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.