Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR |
Activity | Antibacterial |
Host Chemicals | Fagopyrum esculentum |
Length | 40 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.