Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 6464.3 |
Sequence | SISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIP |
Length | 42 |
1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.