Home > Product > Catalog Peptides > Others > FDC-SP (30-85), human

Others

FDC-SP (30-85), human

Price Inquiry
CAT#
F01001
Sequence
SISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIP
M.W/Mr.
6464.3
Length
42

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.