CAT# | F02040 |
M.F/Formula | C190H283N49O66 |
M.W/Mr. | 4309.7 |
Sequence | FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV |
Length | 37 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
F02037 | Fibrinopeptide B, Bovine | Inquiry | ||
F02012 | (Tyr0)-Fibrinopeptide A | Inquiry | ||
F02030 | [Tyr0] Fibrinopeptide A, human | Inquiry | ||
F02050 | Fibronectin Fragment (196-203) | Inquiry | ||
F02031 | [Tyr15] Fibrinopeptide B, human | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...