Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPH |
Length | 49 |
Modifications | Phosphotyrosine |
1. Implications of ligand-receptor binding kinetics on GLP-1R signalling
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.