CAT# | M13011 |
Sequence | SEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPD |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...
Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...