FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)

FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: X21214

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
8314.9
Sequence
One Letter Code: DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Three Letter Code: H-Asp-Arg-Glu-Dap(Nma)-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-Dap(Dnp)-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH
References
K. Kokame, et al. Br. J. Haematol., 129, 93-100 (2005)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide Synthesis ServicesPeptide CDMOPeptide Nucleic Acids SynthesisPeptide Modification ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers