FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.
CAT# | X21214 |
M.W/Mr. | 8314.9 |
Sequence | One Letter Code: DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR Three Letter Code: H-Asp-Arg-Glu-Dap(Nma)-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-Dap(Dnp)-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...