Keywords Search Google Search Search

Gal 9

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2493
Sequence	DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF2334	Class II sec-dependent bacteriocin	Inquiry
AF592	Retrocyclin-2	Inquiry
AF3111	ETD140	Inquiry
AF3145	Beta-defensin103A	Inquiry
AF2642	Enterocin X beta	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Conantokin-T, a naturally peptidic NMDA receptor antagonist

Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...

The application of obestatin (human) in hormonal therapy

Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...

Effects of L-NMMA Acetate in DOCA-salt Hypertension

NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...

GIP (gastric inhibitory polypeptide or glucosedependent insulinotropic peptide)

GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Gallus gallus
Length	36
SwissProt ID	Q6QLR1