Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 6204.1 |
Sequence | APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGIL |
Length | 42 |
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.