Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C141H211N43O41 |
M.W/Mr. | 3164.5 |
Sequence | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
Length | 29 |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.