Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA |
Activity | Antibacterial |
Host Chemicals | Gallus gallus |
Length | 36 |
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.