Keywords Search Google Search Search

Gallinacin-4

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2747
Sequence	RYHMQCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2631	EcAMP1	Inquiry
AF1774	Granulosusin-D1 antimicrobial peptide precursor	Inquiry
AF2247	Brevinin-2-AJ1 antimicrobial peptide precursor	Inquiry
AF2007	Ranatuerin-2BYb precursor	Inquiry
AF2390	Defensin-related cryptdin-20	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Effects of L-NMMA Acetate in DOCA-salt Hypertension

NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...

The mechanism and effect of hexapeptide-9

The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...

A highly selective intravenous anesthetic agent- Etomidate

Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...

Palmitoyl Tripeptide-1

Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...

The effect of terlipressin acetate in the treatment of decompensated liver cirrhosis

Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Gallus gallus
Length	38
SwissProt ID	Q6GXJ1