Gastric Inhibitory Peptide (GIP), human

Gastric Inhibitory Peptide (GIP), human is the standard human GIP preparation used in metabolic signaling research. The peptide contains motifs necessary for GIP receptor engagement and helical structure. Researchers apply it to examine secretion dynamics, proteolytic processing, and receptor activation. Its native sequence is central to biochemical characterization of incretin pathways.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G02009

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C226H338N60O66S1
M.W/Mr.
4983.6
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Length
42

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicescGMP Peptide ServicePeptide Synthesis ServicesPeptide CDMOCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers