Gastric Inhibitory Polypeptide (porcine)

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Gastric Inhibitory Polypeptide (porcine)(CAS 11063-17-5)

CAT No: G02012

CAS No: 11063-17-5

Synonyms/Alias: Gastric Inhibitory Polypeptide (porcine);11063-17-5;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC225H342N60O66S
M.W/Mr.4976
SequenceOne Letter Code:YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Three Letter Code:H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChIInChI=1S/C225H342N60O66S/c1-21-113(11)179(284-216(342)164(108-288)277-202(328)150(91-125-62-66-130(292)67-63-125)264-209(335)160(99-176(307)308)273-215(341)163(107-287)278-220(346)181(115(13)23-3)282-212(338)152(90-123-48-29-26-30-49-123)274-222(348)183(120(18)289)279-172(300)105-245-190(316)142(72-77-173(301)302)251-185(311)117(15)247-188(314)133(231)88-124-60-64-129(291)65-61-124)218(344)249-119(17)187(313)253-146(78-85-352-20)198(324)271-158(97-174(303)304)207(333)257-140(58-39-44-83-230)199(325)281-180(114(12)22-2)219(345)260-141(59-45-84-241-225(238)239)192(318)258-144(69-74-166(233)294)196(322)259-145(70-75-167(234)295)197(323)270-159(98-175(305)306)208(334)265-151(89-122-46-27-25-28-47-122)211(337)280-178(112(9)10)217(343)275-156(95-169(236)297)206(332)266-154(93-127-102-243-135-53-34-32-51-132(127)135)204(330)263-149(87-111(7)8)201(327)262-148(86-110(5)6)200(326)248-118(16)186(312)252-143(68-73-165(232)293)195(321)254-136(54-35-40-79-226)189(315)244-104-171(299)250-137(55-36-41-80-227)191(317)255-139(57-38-43-82-229)194(320)276-162(106-286)214(340)272-161(100-177(309)310)210(336)267-153(92-126-101-242-134-52-33-31-50-131(126)134)203(329)256-138(56-37-42-81-228)193(319)268-155(94-128-103-240-109-246-128)205(331)269-157(96-170(237)298)213(339)283-182(116(14)24-4)221(347)285-184(121(19)290)223(349)261-147(224(350)351)71-76-168(235)296/h25-34,46-53,60-67,101-103,109-121,133,136-164,178-184,242-243,286-292H,21-24,35-45,54-59,68-100,104-108,226-231H2,1-20H3,(H2,232,293)(H2,233,294)(H2,234,295)(H2,235,296)(H2,236,297)(H2,237,298)(H,240,246)(H,244,315)(H,245,316)(H,247,314)(H,248,326)(H,249,344)(H,250,299)(H,251,311)(H,252,312)(H,253,313)(H,254,321)(H,255,317)(H,256,329)(H,257,333)(H,258,318)(H,259,322)(H,260,345)(H,261,349)(H,262,327)(H,263,330)(H,264,335)(H,265,334)(H,266,332)(H,267,336)(H,268,319)(H,269,331)(H,270,323)(H,271,324)(H,272,340)(H,273,341)(H,274,348)(H,275,343)(H,276,320)(H,277,328)(H,278,346)(H,279,300)(H,280,337)(H,281,325)(H,282,338)(H,283,339)(H,284,342)(H,285,347)(H,301,302)(H,303,304)(H,305,306)(H,307,308)(H,309,310)(H,350,351)(H4,238,239,241)/t113-,114-,115-,116-,117-,118-,119-,120+,121+,133-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,178-,179-,180-,181-,182-,183-,184-/m0/s1
InChI KeyPLADHAULGRRDGJ-NHFKDGGBSA-N
Write a review Ask a question
My Review for Gastric Inhibitory Polypeptide (porcine)

Required fields are marked with *

  • Basic Information
×
Ask a Question for Gastric Inhibitory Polypeptide (porcine)

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Angiotensin II

    Angiotensin II human (Angiotensin II) is a vasoconstrictor that mainly acts on the AT1 receptor. Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis.

    Inquiry
  • Carperitide

    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. ANP (1-28) inhibits endothelin-1 secretion in a dose-dependent way.

    Inquiry
  • Argipressin

    Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Terlipressin

    Terlipressin is a synthetic triglycyllysine derivative of vasopressin with vasoconstrictive, antihemorrhagic, and antidiuretic properties. Upon intravenous administration, terlipressin, an inactive prodrug, is biotransformed to its active moiety, lysine vasopressin (LVP), a nonselective vasopressin analogue with affinity for vasopressin receptors V1 (V1a), V2 and V3 (V1b). As a V1 agonist, terlipressin increases systemic vascular resistance, particularly in the splanchnic area, resulting in a decrease of portal pressure. V1 binding also promotes platelet aggregation and glycogenolysis, while V3 binding induces adrenocorticotropic hormone (ACTH) secretion. Compared to vasopressin, terlipressin has a minimal effect on V2 receptors, which are responsible for promotion of water reabsorption in the collecting ducts of the kidney via stimulation of cyclic AMP production.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Carbetocin

    Carbetocin is a long-acting synthetic agonist analogue of human oxytocin, with antihemorrhagic and uterotonic activities. Upon administration, carbetocin targets, binds to and activates peripheral oxytocin receptors that are present on the smooth musculature of the uterus. This causes uterus contractions and prevents excessive bleeding after childbirth, particularly following Cesarean section, and may be used to decrease blood loss during hysteroscopic myomectomy.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Aviptadil Acetate

    Aviptadil, also known as vasoactive intestinal polypeptide (VIP), is a 28 amino acid neuropeptide that belongs to the glucagon-growth hormone-releasing factor secretion superfamily. Aviptadil acts as a potent systemic vasodilator and bronchodilator. It inhibits the proliferation of vascular and bronchial smooth muscle cells and decreases platelet aggregation. These biological effects are mediated by specific VIP receptors.

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.