Gastric Inhibitory Polypeptide (porcine)

Gastric Inhibitory Polypeptide (porcine) is the porcine GIP form used in comparative endocrine research. Sequence homology with human GIP allows fine analysis of species-specific receptor interactions. Researchers apply this peptide to examine folding, secretion, and degradation patterns. Its well-defined backbone is suitable for structural and receptor-binding studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Gastric Inhibitory Polypeptide (porcine)(CAS 11063-17-5)

CAT No: G02012

CAS No:11063-17-5

Synonyms/Alias:Gastric Inhibitory Polypeptide (porcine);11063-17-5;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C225H342N60O66S
M.W/Mr.
4976
Sequence
One Letter Code:YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Three Letter Code:H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChI
InChI=1S/C225H342N60O66S/c1-21-113(11)179(284-216(342)164(108-288)277-202(328)150(91-125-62-66-130(292)67-63-125)264-209(335)160(99-176(307)308)273-215(341)163(107-287)278-220(346)181(115(13)23-3)282-212(338)152(90-123-48-29-26-30-49-123)274-222(348)183(120(18)289)279-172(300)105-245-190(316)142(72-77-173(301)302)251-185(311)117(15)247-188(314)133(231)88-124-60-64-129(291)65-61-124)218(344)249-119(17)187(313)253-146(78-85-352-20)198(324)271-158(97-174(303)304)207(333)257-140(58-39-44-83-230)199(325)281-180(114(12)22-2)219(345)260-141(59-45-84-241-225(238)239)192(318)258-144(69-74-166(233)294)196(322)259-145(70-75-167(234)295)197(323)270-159(98-175(305)306)208(334)265-151(89-122-46-27-25-28-47-122)211(337)280-178(112(9)10)217(343)275-156(95-169(236)297)206(332)266-154(93-127-102-243-135-53-34-32-51-132(127)135)204(330)263-149(87-111(7)8)201(327)262-148(86-110(5)6)200(326)248-118(16)186(312)252-143(68-73-165(232)293)195(321)254-136(54-35-40-79-226)189(315)244-104-171(299)250-137(55-36-41-80-227)191(317)255-139(57-38-43-82-229)194(320)276-162(106-286)214(340)272-161(100-177(309)310)210(336)267-153(92-126-101-242-134-52-33-31-50-131(126)134)203(329)256-138(56-37-42-81-228)193(319)268-155(94-128-103-240-109-246-128)205(331)269-157(96-170(237)298)213(339)283-182(116(14)24-4)221(347)285-184(121(19)290)223(349)261-147(224(350)351)71-76-168(235)296/h25-34,46-53,60-67,101-103,109-121,133,136-164,178-184,242-243,286-292H,21-24,35-45,54-59,68-100,104-108,226-231H2,1-20H3,(H2,232,293)(H2,233,294)(H2,234,295)(H2,235,296)(H2,236,297)(H2,237,298)(H,240,246)(H,244,315)(H,245,316)(H,247,314)(H,248,326)(H,249,344)(H,250,299)(H,251,311)(H,252,312)(H,253,313)(H,254,321)(H,255,317)(H,256,329)(H,257,333)(H,258,318)(H,259,322)(H,260,345)(H,261,349)(H,262,327)(H,263,330)(H,264,335)(H,265,334)(H,266,332)(H,267,336)(H,268,319)(H,269,331)(H,270,323)(H,271,324)(H,272,340)(H,273,341)(H,274,348)(H,275,343)(H,276,320)(H,277,328)(H,278,346)(H,279,300)(H,280,337)(H,281,325)(H,282,338)(H,283,339)(H,284,342)(H,285,347)(H,301,302)(H,303,304)(H,305,306)(H,307,308)(H,309,310)(H,350,351)(H4,238,239,241)/t113-,114-,115-,116-,117-,118-,119-,120+,121+,133-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,178-,179-,180-,181-,182-,183-,184-/m0/s1
InChI Key
PLADHAULGRRDGJ-NHFKDGGBSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide CDMOCustom Conjugation ServicePeptide Analysis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServiceEpitope Mapping ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers