1. Home
  2. Research Areas
  3. Peptides in Diabetes
  4. Gastric Inhibitory Polypeptide and Fragments
  5. Gastric Inhibitory Polypeptide (porcine)

Gastric Inhibitory Polypeptide (porcine)

Gastric Inhibitory Polypeptide (porcine) is the porcine GIP form used in comparative endocrine research. Sequence homology with human GIP allows fine analysis of species-specific receptor interactions. Researchers apply this peptide to examine folding, secretion, and degradation patterns. Its well-defined backbone is suitable for structural and receptor-binding studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Gastric Inhibitory Polypeptide (porcine)(CAS 11063-17-5)

CAT No: G02012

CAS No:11063-17-5

Synonyms/Alias:Gastric Inhibitory Polypeptide (porcine);11063-17-5;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C225H342N60O66S
M.W/Mr.
4976
Sequence
One Letter Code:YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Three Letter Code:H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChI
InChI=1S/C225H342N60O66S/c1-21-113(11)179(284-216(342)164(108-288)277-202(328)150(91-125-62-66-130(292)67-63-125)264-209(335)160(99-176(307)308)273-215(341)163(107-287)278-220(346)181(115(13)23-3)282-212(338)152(90-123-48-29-26-30-49-123)274-222(348)183(120(18)289)279-172(300)105-245-190(316)142(72-77-173(301)302)251-185(311)117(15)247-188(314)133(231)88-124-60-64-129(291)65-61-124)218(344)249-119(17)187(313)253-146(78-85-352-20)198(324)271-158(97-174(303)304)207(333)257-140(58-39-44-83-230)199(325)281-180(114(12)22-2)219(345)260-141(59-45-84-241-225(238)239)192(318)258-144(69-74-166(233)294)196(322)259-145(70-75-167(234)295)197(323)270-159(98-175(305)306)208(334)265-151(89-122-46-27-25-28-47-122)211(337)280-178(112(9)10)217(343)275-156(95-169(236)297)206(332)266-154(93-127-102-243-135-53-34-32-51-132(127)135)204(330)263-149(87-111(7)8)201(327)262-148(86-110(5)6)200(326)248-118(16)186(312)252-143(68-73-165(232)293)195(321)254-136(54-35-40-79-226)189(315)244-104-171(299)250-137(55-36-41-80-227)191(317)255-139(57-38-43-82-229)194(320)276-162(106-286)214(340)272-161(100-177(309)310)210(336)267-153(92-126-101-242-134-52-33-31-50-131(126)134)203(329)256-138(56-37-42-81-228)193(319)268-155(94-128-103-240-109-246-128)205(331)269-157(96-170(237)298)213(339)283-182(116(14)24-4)221(347)285-184(121(19)290)223(349)261-147(224(350)351)71-76-168(235)296/h25-34,46-53,60-67,101-103,109-121,133,136-164,178-184,242-243,286-292H,21-24,35-45,54-59,68-100,104-108,226-231H2,1-20H3,(H2,232,293)(H2,233,294)(H2,234,295)(H2,235,296)(H2,236,297)(H2,237,298)(H,240,246)(H,244,315)(H,245,316)(H,247,314)(H,248,326)(H,249,344)(H,250,299)(H,251,311)(H,252,312)(H,253,313)(H,254,321)(H,255,317)(H,256,329)(H,257,333)(H,258,318)(H,259,322)(H,260,345)(H,261,349)(H,262,327)(H,263,330)(H,264,335)(H,265,334)(H,266,332)(H,267,336)(H,268,319)(H,269,331)(H,270,323)(H,271,324)(H,272,340)(H,273,341)(H,274,348)(H,275,343)(H,276,320)(H,277,328)(H,278,346)(H,279,300)(H,280,337)(H,281,325)(H,282,338)(H,283,339)(H,284,342)(H,285,347)(H,301,302)(H,303,304)(H,305,306)(H,307,308)(H,309,310)(H,350,351)(H4,238,239,241)/t113-,114-,115-,116-,117-,118-,119-,120+,121+,133-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,178-,179-,180-,181-,182-,183-,184-/m0/s1
InChI Key
PLADHAULGRRDGJ-NHFKDGGBSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOcGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Synthesis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Analysis Services
Hot Products
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Read More Read More
Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

Read More Read More
GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Read More Read More
Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers